General Information

  • ID:  hor002255
  • Uniprot ID:  A0A0L0C574
  • Protein name:  Leucokinin
  • Gene name:  NA
  • Organism:  Lucilia cuprina (Green bottle fly) (Australian sheep blowfly)
  • Family:  Kinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lucilia (genus), Luciliinae (subfamily), Calliphoridae (family), Oestroidea (superfamily), Calyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0016020 membrane

Sequence Information

  • Sequence:  NSVVLGKKQRFHSWG
  • Length:  15
  • Propeptide:  MPGYSFKMHSYHLIFAEITVTSPLHPFLNMMSIRSLLLVVFICFWYSYAKAETSRDLQNCETHLNKYRKFLLQAILSFEDVCDAYNARANPSADTVFPPQIAFFGRYQPTEQKTEVWSFFKLLMAQFNDMEFSNIIRDAVIERCHMKYQMQQQQQRDEKRNSVVLGKKQRFHSWGGKRSGNDLEQDHNDDVNLSF
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A0L0C574-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002255_AF2.pdbhor002255_ESM.pdb

Physical Information

Mass: 199289 Formula: C79H123N25O20
Absent amino acids: ACDEIMPTY Common amino acids: GKSV
pI: 11.82 Basic residues: 4
Polar residues: 5 Hydrophobic residues: 5
Hydrophobicity: -72 Boman Index: -2947
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 64.67
Instability Index: 1194.67 Extinction Coefficient cystines: 5500
Absorbance 280nm: 392.86

Literature

  • PubMed ID:  23280433
  • Title:  Neuropeptidomics of the Australian Sheep Blowfly Lucilia Cuprina (Wiedemann) and Related Diptera